Google
×
Past 24 hours
  • Any time
  • Past hour
  • Past 24 hours
  • Past week
  • Past month
  • Past year
All results

Acromegaly

Also called: gigantism
A disorder in adults in which the pituitary gland produces too much growth hormone.
  • Treatment can help, but this condition can't be cured
  • Requires a medical diagnosis
  • Lab tests or imaging always required
  • Chronic: can last for years or be lifelong
Acromegaly is usually caused by a noncancerous tumor. Middle-aged adults are most commonly affected.
Symptoms include enlargement of the face, hands, and feet.
Prompt treatment is needed to avoid serious illness. Drugs can reduce the effects of growth hormone. If needed, surgery and radiation may be used to remove tumor cells.
Very rare: Fewer than 20,000 US cases per year
Consult a doctor for medical advice Sources: Mayo Clinic and others. Learn more

Learn to pronounce ac·ro·meg·a·ly

/ˌakrōˈmeɡəlē/
noun
abnormal growth of the hands, feet, and face, caused by overproduction of growth hormone by the pituitary gland.

20 hours ago · ACROMEGALY pronunciation. How to say ACROMEGALY. Listen to the audio pronunciation in English. Learn more.
4 hours ago · acromegaly: from growth-hormone secreting pituitary adenomas. Cushing syndrome: most common endocrine presentation; related to primary pigmented nodular ...
6 hours ago · Acromegaly is a rare chronic disorder caused by the excessive growth hormone (GH) and insulin-like growth factor-1 (IGF-1). Common clinical features include ...
Rating · Review by Valentine Hammes
12 hours ago · Meanings for acromegaly. It is the name of the disorder of an excess growth hormone in the pituitary gland. It is identified by enlargement of the face or hands ...
15 hours ago · Question: Hypersecretion of human growth hormone during adulthood can causeacromegalygigantismdwarfismhypercalcemia. Hypersecretion of human growth hormone ...
22 hours ago · This repository contains the supplementary appendix for the research article: Digital voice analysis as a biomarker of acromegaly. Funding. The study was ...
11 hours ago · Acromegaly is a chronic disease that affects multiple systems in the body. It is caused by an overproduction of growth hormone (GH) and insulin-like.
3 hours ago · Generic version of injectable acromegaly treatment launches in US ... A generic version of a treatment for acromegaly is now available for adults in the U.S., ...
23 hours ago · Acropachy literally means "thick¬ ening of the extremities." This en¬ largement involves soft tissue and bone, with drumstick clubbing,.
10 hours ago · Somatostatin receptor ligands in acromegaly: clinical response and factors predicting resistance. Pituitary. 2017;20(1):109–15. Article CAS PubMed Google ...